CompPASS © 2007-2010 Mathew E. Sowa, J. Wade Harper &
President and Fellows of Harvard University
Website designed, written and maintained by M. Sowa.

Search Downloads Tutorials Feedback & Requests

PRKAA2
Download CompPASS data for PRKAA2

Ascending Descending

Found In

TARDBP
BaitTSCWDN-ScoreDN-ScoreZ-Score
WIPI-250.130.134.62
ATG10140.230.233.58
CLN340.110.113.58
DMWD40.230.233.58
USP1140.230.233.58
USP3240.110.113.58
DDA130.100.102.55
GBAS30.200.202.55
UIMC130.200.202.55
USP1930.200.202.55
WDR2030.200.202.55
ATG16L120.080.081.52
FOXO3A20.160.161.52
GABARAP20.160.161.52
GBL20.160.161.52
NBA120.160.161.52
KLHDC1020.080.081.52
ATG1420.160.161.52
NEK920.080.081.52
NSF20.080.081.52
OTUD420.160.161.52
PIK3C2A20.160.161.52
PRKAA220.080.081.52
PRKAG120.160.161.52
PRKAG220.160.161.52
USP1620.080.081.52
USP3020.160.161.52
USP4320.160.161.52
USP4520.160.161.52
USP4920.160.161.52
WDR4520.160.161.52
ATG510.060.060.48
BRE10.060.060.48
OSBPL910.120.120.48
PHLPP10.060.060.48
A2010.060.060.48
USP210.060.060.48
USP3310.060.060.48
USP3810.060.060.48
WIPI-110.060.060.48

Peptide Information from RUN 1

You wanted to see the peptide information for TARDBP from Run 1.


IPI00025815 ( 414 aa  &nsbp 44740 MW Da)
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI
LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL
KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA
QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG
NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM

Perecent Coverage=5.80%

PeptideChargeXCorrDeltaCn
K.GISVHISNAEPK.H22.05850.1699
K.TSDLIVLGLPWK.T22.95410.2324

Peptide Information from RUN 2

You wanted to see the peptide information for TARDBP from Run 2.


IPI00025815 ( 414 aa    44740 MW Da)
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI
LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL
KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA
QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG
NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM

Perecent Coverage=5.80%

PeptideChargeXCorrDeltaCn
K.GISVHISNAEPK.H22.05850.1699
K.TSDLIVLGLPWK.T22.95410.2324

Z-Score %TAPs Ratio SN-Score DN-score WDN-score p-value FIDR? Symbol TSC GeneID IPI Number Gene Description (IPI Description)
1. 12.64 4.8% 8/167 4.39 6.69 12.51 <1E-15 YES PRKAB2 133 5565 IPI00013905 protein kinase, AMP-activated, beta 2 non-catalytic subunit---5'-AMP-activated protein kinase subunit beta-2
2. 12.05 1.2% 2/167 3.88 11.83 11.83 <1E-15 YES STIM2 26 57620 IPI00001727 stromal interaction molecule 2---stromal interaction molecule 2
3. 12.86 1.2% 2/167 3.05 9.28 11.60 <1E-15 YES MLF2 16 8079 IPI00023095 myeloid leukemia factor 2---Myeloid leukemia factor 2
4. 11.54 1.2% 2/167 3.23 9.84 9.84 <1E-15 YES SH3PXD2A 18 9644 IPI00400923 SH3 and PX domains 2A---SH3 multiple domains 1
5. 12.59 1.2% 2/167 3.23 9.84 9.84 <1E-15 YES STIM1 18 6786 IPI00299063 stromal interaction molecule 1---Stromal interaction molecule 1 precursor
6. 12.88 0.6% 1/167 2.15 9.28 9.28 4.66E-03 YES SLC4A7 4 9497 IPI00719757
IPI00021058
solute carrier family 4, sodium bicarbonate cotransporter, member 7---Isoform 5 of Sodium bicarbonate cotransporter 3
7. 11.21 1.2% 2/167 2.85 8.68 8.68 <1E-15 YES KIAA0284 14 283638 IPI00180625 KIAA0284---Isoform 2 of Protein KIAA0284
8. 11.21 1.2% 2/167 2.85 8.68 8.68 <1E-15 YES MAST3 14 23031 IPI00028932 microtubule associated serine/threonine kinase 3---Microtubule-associated serine/threonine-protein kinase 3
9. 5.38 1.2% 2/167 2.75 8.36 8.36 <1E-15 YES MAP3K5 13 4217 IPI00412433 mitogen-activated protein kinase kinase kinase 5---Mitogen-activated protein kinase kinase kinase 5
10. 8.73 1.2% 2/167 2.64 8.03 8.03 <1E-15 YES MAP3K6 12 9064 IPI00418221 mitogen-activated protein kinase kinase kinase 6---mitogen-activated protein kinase kinase kinase 6
11. 9.10 10.8% 18/167 3.61 3.66 7.47 <1E-15 YES PRKAG1 202 5571 IPI00413318 protein kinase, AMP-activated, gamma 1 non-catalytic subunit---5'-AMP-activated protein kinase subunit gamma-1
12. 8.20 4.2% 7/167 3.90 6.36 6.99 <1E-15 YES PRKAA2 92 5563 IPI00307755 protein kinase, AMP-activated, alpha 2 catalytic subunit---5'-AMP-activated protein kinase catalytic subunit alpha-2
13. 10.74 1.2% 2/167 2.28 6.96 6.96 <1E-15 YES BAIAP2L1 9 55971 IPI00179326 BAI1-associated protein 2-like 1---Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1
14. 9.56 1.8% 3/167 2.78 6.92 6.92 <1E-15 YES GYG1 20 2992 IPI00180386 glycogenin 1---Isoform GN-1L of Glycogenin-1
15. 9.33 4.2% 7/167 3.05 4.96 6.55 <1E-15 YES GYS1 56 2997 IPI00157144 glycogen synthase 1 (muscle)---GYS1 protein
16. 8.29 3.6% 6/167 3.26 5.73 6.08 <1E-15 YES PRKAG2 55 51422 IPI00005367 protein kinase, AMP-activated, gamma 2 non-catalytic subunit---Isoform A of 5'-AMP-activated protein kinase subunit gamma-2
17. 8.48 6.0% 10/167 3.81 5.19 5.50 <1E-15 YES PRKAA1 125 5562 IPI00011891 protein kinase, AMP-activated, alpha 1 catalytic subunit---5'-AMP-activated protein kinase catalytic subunit alpha-1
18. 3.17 2.4% 4/167 1.86 4.02 5.14 <1E-15 YES PIK3CG 12 5294 IPI00292690 phosphoinositide-3-kinase, catalytic, gamma polypeptide---Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
19. 12.88 0.6% 1/167 1.08 4.64 4.64 2.12E-01 YES DHFR 1 1719 IPI00030357 dihydrofolate reductase---Dihydrofolate reductase
20. 10.32 1.2% 2/167 1.52 4.64 4.64 4.66E-03 YES PPP1R3D 4 5509 IPI00006682 protein phosphatase 1, regulatory (inhibitor) subunit 3D---Protein phosphatase 1 regulatory subunit 3D
21. 12.18 1.8% 3/167 1.76 4.37 4.37 1.28E-12 YES FLCN 8 201163 IPI00329635
IPI00185096
folliculin---65 kDa protein
22. 9.93 1.8% 3/167 1.52 3.79 3.79 7.93E-07 YES FNIP1 6 96459 IPI00386797 folliculin interacting protein 1---folliculin interacting protein 1 isoform 1
23. 9.11 1.2% 2/167 1.08 3.28 3.28 3.82E-01 YES DNAJB4 2 11080 IPI00003848 DnaJ (Hsp40) homolog, subfamily B, member 4---DnaJ homolog subfamily B member 4
24. 11.54 1.2% 2/167 1.08 3.28 3.28 3.82E-01 YES HISPPD2A 2 9677 IPI00005663 histidine acid phosphatase domain containing 2A---KIAA0377 protein
25. 10.14 1.8% 3/167 1.24 3.09 3.09 4.66E-03 YES CHORDC1 4 26973 IPI00015897 cysteine and histidine-rich domain (CHORD)-containing 1---Cysteine and histidine-rich domain-containing protein 1
26. 8.25 1.8% 3/167 1.08 2.68 2.68 8.08E-02 YES CAMKK2 3 10645 IPI00170509 calcium/calmodulin-dependent protein kinase kinase 2, beta---Isoform 3 of Calcium/calmodulin-dependent protein kinase kinase 2
27. 8.88 1.8% 3/167 1.08 2.68 2.68 8.08E-02 YES DKFZp667G2110 3 131544 IPI00401026 hypothetical protein DKFZp667G2110---hypothetical protein LOC131544
28. 5.66 1.8% 3/167 1.08 2.68 2.68 8.08E-02 YES NET1 3 10276 IPI00098952
IPI00385312
neuroepithelial cell transforming gene 1---Isoform 1 of Neuroepithelial cell-transforming gene 1 protein
29. 2.89 3.0% 5/167 1.36 2.62 2.62 1.28E-12 YES AMOT 8 154796 IPI00163085 angiomotin---Isoform 1 of Angiomotin
30. 8.87 3.0% 5/167 1.27 2.45 2.45 1.82E-09 YES PARS2 7 25973 IPI00553006 prolyl-tRNA synthetase 2, mitochondrial (putative)---Probable prolyl-tRNA synthetase, mitochondrial precursor
31. 9.90 3.6% 6/167 1.08 1.89 1.89 7.93E-07 YES DFFA 6 1676 IPI00010882 DNA fragmentation factor, 45kDa, alpha polypeptide---Isoform DFF45 of DNA fragmentation factor subunit alpha (Fragment)
32. 7.28 3.6% 6/167 0.98 1.73 1.73 1.08E-04 YES ACACA 5 31 IPI00011569 acetyl-Coenzyme A carboxylase alpha---Acetyl-CoA carboxylase 1
33. 5.02 2.4% 4/167 0.76 1.64 1.64 3.82E-01 YES GYS2 2 2998 IPI00008867 glycogen synthase 2 (liver)---Glycogen [starch] synthase, liver
34. 2.30 5.4% 9/167 1.14 1.63 1.63 <1E-15 YES RB1CC1 10 9821 IPI00783392
IPI00291638
RB1-inducible coiled-coil 1---RB1-inducible coiled-coil protein 1
35. 6.06 5.4% 9/167 1.01 1.46 1.46 1.28E-12 YES ULK1 8 8408 IPI00289357 unc-51-like kinase 1 (C. elegans)---Serine/threonine-protein kinase ULK1
36. 5.22 4.8% 8/167 0.76 1.16 1.16 4.66E-03 YES PDIA3 4 2923 IPI00025252 protein disulfide isomerase family A, member 3---Protein disulfide-isomerase A3 precursor
37. 6.30 5.4% 9/167 0.80 1.15 1.15 1.08E-04 YES DNAJB1 5 3337 IPI00015947 DnaJ (Hsp40) homolog, subfamily B, member 1---DnaJ homolog subfamily B member 1
38. 8.94 7.2% 12/167 0.88 1.09 1.09 1.28E-12 YES GFPT1 8 2673 IPI00217952 glutamine-fructose-6-phosphate transaminase 1---Isoform 1 of Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1
39. 0.19 3.6% 6/167 0.44 0.77 1.07 2.12E-01 YES C12orf44 1 60673 IPI00305296
IPI00075206
chromosome 12 open reading frame 44---Uncharacterized protein C12orf44
40. 4.95 4.2% 7/167 0.58 0.94 0.94 NA YES BAG5 2 9529 IPI00007731 BCL2-associated athanogene 5---BAG family molecular chaperone regulator 5
41. 1.14 5.4% 9/167 0.51 0.73 0.94 NA YES XPOT 2 11260 IPI00306290 exportin, tRNA (nuclear export receptor for tRNAs)---110 kDa protein
42. 6.32 5.4% 9/167 0.62 0.89 0.89 NA YES GFPT2 3 9945 IPI00216159 glutamine-fructose-6-phosphate transaminase 2---Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2
43. 0.56 5.4% 9/167 0.51 0.73 0.85 NA YES NUDC 2 10726 IPI00550746 nuclear distribution gene C homolog (A. nidulans)---Nuclear migration protein nudC
44. 0.92 15.6% 26/167 0.52 0.44 0.76 NA YES SMC1A 6 8243 IPI00291939 structural maintenance of chromosomes 1A---Structural maintenance of chromosomes protein 1A
45. 2.75 35.9% 60/167 0.76 0.42 0.72 NA YES AGL 30 178 IPI00328318
IPI00219065
amylo-1, 6-glucosidase, 4-alpha-glucanotransferase (glycogen debranching enzyme, glycogen storage disease type III)---Isoform 5 of Glycogen debranching enzyme
46. 0.79 18.6% 31/167 0.43 0.33 0.70 NA YES SMC3 5 9126 IPI00219420 structural maintenance of chromosomes 3---Structural maintenance of chromosomes protein 3
47. 2.69 7.2% 12/167 0.54 0.67 0.67 NA YES VPS35 3 55737 IPI00018931 vacuolar protein sorting 35 homolog (S. cerevisiae)---Vacuolar protein sorting-associated protein 35
48. 6.49 8.4% 14/167 0.58 0.66 0.66 NA YES DNAJB6 4 10049 IPI00024523 DnaJ (Hsp40) homolog, subfamily B, member 6---Isoform A of DnaJ homolog subfamily B member 6
49. 12.88 0.6% 1/167 1.86 0.62 0.62 NA NO C1orf55 3 163859 IPI00167998 chromosome 1 open reading frame 55---Uncharacterized protein C1orf55
50. 3.19 6.6% 11/167 0.46 0.60 0.60 NA YES CA2 2 760 IPI00218414 carbonic anhydrase II---Carbonic anhydrase 2
51. 0.00 34.7% 58/167 0.28 0.16 0.59 NA YES VCP 4 7415 IPI00022774 valosin-containing protein---Transitional endoplasmic reticulum ATPase
52. 1.60 4.8% 8/167 0.38 0.58 0.58 NA YES GPRASP2 1 114928 IPI00069232 G protein-coupled receptor associated sorting protein 2---G-protein coupled receptor-associated sorting protein 2
53. 0.29 25.1% 42/167 0.33 0.22 0.56 NA YES PSMC4 4 5704 IPI00020042 proteasome (prosome, macropain) 26S subunit, ATPase, 4---Isoform 1 of 26S protease regulatory subunit 6B
54. 0.02 22.2% 37/167 0.31 0.22 0.56 NA YES PSMD2 3 5708 IPI00012268 proteasome (prosome, macropain) 26S subunit, non-ATPase, 2---26S proteasome non-ATPase regulatory subunit 2
55. 0.18 24.6% 41/167 0.34 0.23 0.55 NA YES PSMC3 4 5702 IPI00018398 proteasome (prosome, macropain) 26S subunit, ATPase, 3---26S protease regulatory subunit 6A
56. 2.67 7.2% 12/167 0.44 0.55 0.55 NA YES VBP1 2 7411 IPI00334159 von Hippel-Lindau binding protein 1---Von Hippel-Lindau binding protein 1
57. 1.52 40.7% 68/167 0.77 0.40 0.54 NA YES PRKDC 35 5591 IPI00296337 protein kinase, DNA-activated, catalytic polypeptide---Isoform 1 of DNA-dependent protein kinase catalytic subunit
58. 0.13 20.4% 34/167 0.32 0.24 0.51 NA YES PSMC1 3 5700 IPI00011126 proteasome (prosome, macropain) 26S subunit, ATPase, 1---26S protease regulatory subunit 4
59. 12.88 0.6% 1/167 1.52 0.51 0.51 NA NO PHACTR4 2 65979 IPI00217851 phosphatase and actin regulator 4---phosphatase and actin regulator 4 isoform 1
60. 0.00 15.0% 25/167 0.37 0.32 0.50 NA YES ATG4B 3 23192 IPI00470477
IPI00064500
ATG4 autophagy related 4 homolog B (S. cerevisiae)---Isoform 3 of Cysteine protease ATG4B
61. 2.71 9.0% 15/167 0.39 0.44 0.44 NA YES SMC4 2 10051 IPI00328298 structural maintenance of chromosomes 4---Isoform 2 of Structural maintenance of chromosomes protein 4
62. 10.74 1.2% 2/167 1.32 0.44 0.44 NA NO ULK2 3 9706 IPI00479399 unc-51-like kinase 2 (C. elegans)---Serine/threonine-protein kinase ULK2
63. 0.06 28.1% 47/167 0.27 0.17 0.43 NA YES PSMC5 3 5705 IPI00023919 proteasome (prosome, macropain) 26S subunit, ATPase, 5---26S protease regulatory subunit 8
64. 1.04 13.2% 22/167 0.46 0.42 0.42 NA YES NoSymbol 4 0 IPI00738850 No Additional Information---No Additional Information
65. 1.52 6.6% 11/167 0.33 0.42 0.42 NA YES TUBA1A 1 7846 IPI00180675 tubulin, alpha 1a---Tubulin alpha-3 chain
66. -0.06 19.8% 33/167 0.27 0.20 0.41 NA YES USP7 2 7874 IPI00003965 ubiquitin specific peptidase 7 (herpes virus-associated)---Ubiquitin carboxyl-terminal hydrolase 7
67. 1.70 19.8% 33/167 0.46 0.34 0.40 NA YES DNAJC7 6 7266 IPI00329629 DnaJ (Hsp40) homolog, subfamily C, member 7---DnaJ homolog subfamily C member 7
68. 1.93 10.2% 17/167 0.37 0.39 0.39 NA YES MMS19L 2 64210 IPI00154451 MMS19-like (MET18 homolog, S. cerevisiae)---Isoform 1 of MMS19-like protein
69. 2.11 10.2% 17/167 0.37 0.39 0.39 NA YES PSME3 2 10197 IPI00030243 proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)---Isoform 1 of Proteasome activator complex subunit 3
70. 0.26 41.3% 69/167 0.37 0.19 0.38 NA YES YWHAE 8 7531 IPI00000816 tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide---14-3-3 protein epsilon
71. 9.11 1.2% 2/167 1.08 0.36 0.36 NA NO ARHGAP8 2 23779 IPI00017910 Rho GTPase activating protein 8---Isoform 8 of Rho GTPase-activating protein 8
72. 3.68 10.8% 18/167 0.36 0.36 0.36 NA YES LOC389842 2 389842 IPI00399212 similar to Ran-specific GTPase-activating protein (Ran-binding protein 1) (RanBP1)---similar to Ran-specific GTPase-activating protein
73. 12.88 0.6% 1/167 1.08 0.36 0.36 NA NO LOC728513 1 728513 IPI00059235 similar to paraneoplastic antigen MA3---similar to paraneoplastic antigen MA3
74. 2.89 7.8% 13/167 0.30 0.36 0.36 NA YES SUMO2 1 6613 IPI00140827 SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)---similar to SMT3 suppressor of mif two 3 homolog 2
75. 12.88 0.6% 1/167 1.08 0.36 0.36 NA NO EPHB2 1 2048 IPI00021275 EPH receptor B2---Isoform 1 of Ephrin type-B receptor 2 precursor
76. 12.88 0.6% 1/167 1.08 0.36 0.36 NA NO LRRC49 1 54839 IPI00292794 leucine rich repeat containing 49---Leucine-rich repeat-containing protein 49
77. 12.88 0.6% 1/167 1.08 0.36 0.36 NA NO PNPLA7 1 375775 IPI00394981 patatin-like phospholipase domain containing 7---Patatin-like phospholipase domain containing 7
78. 1.97 11.4% 19/167 0.35 0.35 0.35 NA YES PPM1G 2 5496 IPI00006167 protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform---Protein phosphatase 2C isoform gamma
79. 1.53 11.4% 19/167 0.35 0.35 0.35 NA YES RCC1 2 1104 IPI00001661 regulator of chromosome condensation 1---regulator of chromosome condensation 1 isoform a
80. 2.17 9.0% 15/167 0.28 0.31 0.31 NA YES NUBP2 1 10101 IPI00644674 nucleotide binding protein 2 (MinD homolog, E. coli)---Nucleotide-binding protein 2
81. 2.17 100.0% 167/167 0.87 0.29 0.29 NA NO HSPA8 110 3312 IPI00003865 heat shock 70kDa protein 8---Isoform 1 of Heat shock cognate 71 kDa protein
82. 0.91 13.8% 23/167 0.32 0.29 0.29 NA YES TRIP13 2 9319 IPI00003505 thyroid hormone receptor interactor 13---Isoform 1 of Thyroid receptor-interacting protein 13
83. 3.82 1.8% 3/167 0.88 0.29 0.29 NA NO GEMIN4 2 50628 IPI00027717 gem (nuclear organelle) associated protein 4---Component of gems 4
84. 3.37 1.8% 3/167 0.88 0.29 0.29 NA NO TNRC15 2 26058 IPI00719004
IPI00169434
trinucleotide repeat containing 15---TNRC15 protein (Fragment)
85. 0.94 29.3% 49/167 0.46 0.28 0.28 NA YES DYNC1H1 9 1778 IPI00456969 dynein, cytoplasmic 1, heavy chain 1---Dynein heavy chain, cytosolic
86. 0.01 13.8% 23/167 0.45 0.15 0.28 NA NO FLNC 4 2318 IPI00178352 filamin C, gamma (actin binding protein 280)---Isoform 1 of Filamin-C
87. 4.83 35.9% 60/167 0.48 0.27 0.27 NA YES BAG2 12 9532 IPI00000643 BCL2-associated athanogene 2---BAG family molecular chaperone regulator 2
88. 1.17 14.4% 24/167 0.31 0.27 0.27 NA YES NME1 2 4830 IPI00026260 non-metastatic cells 1, protein (NM23A) expressed in---Nucleoside diphosphate kinase B
89. 3.44 14.4% 24/167 0.31 0.27 0.27 NA YES PFN2 2 5217 IPI00107555 profilin 2---Isoform IIb of Profilin-2
90. 0.99 15.0% 25/167 0.30 0.26 0.26 NA YES C1orf57 2 84284 IPI00031570 chromosome 1 open reading frame 57---Probable UPF0334 kinase-like protein C1orf57
91. 2.00 10.8% 18/167 0.25 0.26 0.26 NA YES IDH3B 1 3420 IPI00010347 isocitrate dehydrogenase 3 (NAD+) beta---isocitrate dehydrogenase 3, beta subunit isoform c
92. -0.16 38.9% 65/167 0.23 0.12 0.26 NA YES USP11 3 8237 IPI00184533 ubiquitin specific peptidase 11---ubiquitin specific protease 11
93. 7.16 2.4% 4/167 0.76 0.25 0.25 NA NO CYFIP2 2 26999 IPI00551011 cytoplasmic FMR1 interacting protein 2---95 kDa protein
94. 9.11 1.2% 2/167 0.76 0.25 0.25 NA NO ISYNA1 1 51477 IPI00478861 myo-inositol 1-phosphate synthase A1---55 kDa protein
95. 9.11 1.2% 2/167 0.76 0.25 0.25 NA NO PIH1D1 1 55011 IPI00550995 PIH1 domain containing 1---Protein NOP17
96. 2.57 15.6% 26/167 0.30 0.25 0.25 NA YES PSMA5 2 5686 IPI00291922 proteasome (prosome, macropain) subunit, alpha type, 5---Proteasome subunit alpha type 5
97. 1.11 19.2% 32/167 0.33 0.25 0.25 NA YES STUB1 3 10273 IPI00025156 STIP1 homology and U-box containing protein 1---Isoform 1 of STIP1 homology and U box-containing protein 1
98. 6.05 3.6% 6/167 0.76 0.25 0.25 NA NO SMC2 3 10592 IPI00007927 structural maintenance of chromosomes 2---Isoform 1 of Structural maintenance of chromosomes protein 2
99. 3.10 22.8% 38/167 0.35 0.24 0.24 NA YES GARS 4 2617 IPI00465260 glycyl-tRNA synthetase---Glycyl-tRNA synthetase
100. 1.52 25.7% 43/167 0.37 0.24 0.24 NA YES GART 5 2618 IPI00025273 phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase---Isoform Long of Trifunctional purine biosynthetic protein adenosine-3
101. 1.52 37.7% 63/167 0.33 0.18 0.24 NA YES YWHAQ 6 10971 IPI00018146 tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide---14-3-3 protein theta
102. 7.99 4.2% 7/167 0.71 0.24 0.24 NA NO C20orf4 3 25980 IPI00166013 chromosome 20 open reading frame 4---Uncharacterized protein C20orf4
103. 0.96 16.8% 28/167 0.29 0.23 0.23 NA YES ALDOA 2 226 IPI00465439 aldolase A, fructose-bisphosphate---Fructose-bisphosphate aldolase A
104. 2.29 80.8% 135/167 0.63 0.23 0.23 NA YES CAD 46 790 IPI00301263 carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase---CAD protein
105. 7.81 3.0% 5/167 0.68 0.23 0.23 NA NO EIF4H 2 7458 IPI00014263 eukaryotic translation initiation factor 4H---Isoform Long of Eukaryotic translation initiation factor 4H
106. 2.29 16.8% 28/167 0.29 0.23 0.23 NA YES HSDL2 2 84263 IPI00031107 hydroxysteroid dehydrogenase like 2---HSDL2 protein
107. 3.23 24.6% 41/167 0.34 0.23 0.23 NA YES PRDX6 4 9588 IPI00220301 peroxiredoxin 6---Peroxiredoxin-6
108. 0.66 19.2% 32/167 0.27 0.20 0.23 NA YES YWHAG 2 7532 IPI00220642 tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide---14-3-3 protein gamma
109. 0.88 18.0% 30/167 0.28 0.22 0.22 NA YES CANX 2 821 IPI00020984 calnexin---Calnexin precursor
110. 4.36 4.8% 8/167 0.66 0.22 0.22 NA NO CTTN 3 2017 IPI00029601 cortactin---Src substrate cortactin
111. 0.18 64.7% 108/167 0.33 0.14 0.21 NA YES CCT2 10 10576 IPI00297779 chaperonin containing TCP1, subunit 2 (beta)---T-complex protein 1 subunit beta
112. 1.35 100.0% 167/167 0.64 0.21 0.21 NA NO HSPA1B 58 3304 IPI00304925 heat shock 70kDa protein 1B---Heat shock 70 kDa protein 1
113. 5.22 1.8% 3/167 0.62 0.21 0.21 NA NO CALU 1 813 IPI00014537 calumenin---Isoform 1 of Calumenin precursor
114. 2.31 80.2% 134/167 0.53 0.20 0.20 NA YES HSPD1 32 3329 IPI00472102 heat shock 60kDa protein 1 (chaperonin)---61 kDa protein
115. 1.43 100.0% 167/167 0.59 0.20 0.20 NA NO TUBB2C 51 10383 IPI00007752 tubulin, beta 2C---Tubulin beta-2C chain
116. 1.09 35.9% 60/167 0.34 0.19 0.19 NA YES ATP1A1 6 476 IPI00006482 ATPase, Na+/K+ transporting, alpha 1 polypeptide---Isoform Long of Sodium/potassium-transporting ATPase alpha-1 chain precursor
117. 3.40 32.9% 55/167 0.33 0.19 0.19 NA YES KHDRBS1 5 10657 IPI00008575 KH domain containing, RNA binding, signal transduction associated 1---Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1
118. -0.07 100.0% 167/167 0.57 0.19 0.19 NA NO KRT1 46 3848 IPI00220327 keratin 1 (epidermolytic hyperkeratosis)---Keratin, type II cytoskeletal 1
119. 1.20 31.7% 53/167 0.30 0.17 0.19 NA YES PPP2R1A 4 5518 IPI00168184 protein phosphatase 2 (formerly 2A), regulatory subunit A , alpha isoform---CDNA FLJ34068 fis, clone FCBBF3001918, highly similar to SERINE/THREONINE PROTEIN PHOSPHATASE 2A, 65 kDa REGULATORY SUBUNIT A, ALPHA ISOFORM
120. -0.02 15.0% 25/167 0.37 0.12 0.19 NA NO PSMD3 3 5709 IPI00011603 proteasome (prosome, macropain) 26S subunit, non-ATPase, 3---26S proteasome non-ATPase regulatory subunit 3
121. 6.49 4.2% 7/167 0.58 0.19 0.19 NA NO PSMA2 2 5683 IPI00219622 proteasome (prosome, macropain) subunit, alpha type, 2---Proteasome subunit alpha type 2
122. 0.05 42.5% 71/167 0.29 0.15 0.18 NA YES CCT7 5 10574 IPI00018465 chaperonin containing TCP1, subunit 7 (eta)---T-complex protein 1 subunit eta
123. 1.59 2.4% 4/167 0.54 0.18 0.18 NA NO FAF1 1 11124 IPI00070643 Fas (TNFRSF6) associated factor 1---Isoform Long of FAS-associated factor 1
124. 0.93 48.5% 81/167 0.38 0.18 0.18 NA YES IRS4 10 8471 IPI00020729 insulin receptor substrate 4---insulin receptor substrate 4
125. 0.18 92.2% 154/167 0.53 0.18 0.18 NA YES KRT9 37 3857 IPI00019359 keratin 9 (epidermolytic palmoplantar keratoderma)---Keratin, type I cytoskeletal 9
126. 0.80 41.9% 70/167 0.32 0.16 0.18 NA YES MCM3 6 4172 IPI00013214 MCM3 minichromosome maintenance deficient 3 (S. cerevisiae)---DNA replication licensing factor MCM3
127. 1.81 21.6% 36/167 0.25 0.18 0.18 NA YES SSR1 2 6745 IPI00301021 signal sequence receptor, alpha (translocon-associated protein alpha)---Isoform 1 of Translocon-associated protein subunit alpha precursor
128. 1.66 99.4% 166/167 0.54 0.18 0.18 NA YES TUBA4A 41 7277 IPI00007750 tubulin, alpha 4a---Tubulin alpha-1 chain
129. 4.83 2.4% 4/167 0.54 0.18 0.18 NA NO ATPBD1C 1 51184 IPI00470580 ATP binding domain 1 family, member C---Protein x 0004 variant
130. -0.04 12.0% 20/167 0.34 0.11 0.18 NA NO PSMD1 2 5707 IPI00299608 proteasome (prosome, macropain) 26S subunit, non-ATPase, 1---Isoform 1 of 26S proteasome non-ATPase regulatory subunit 1
131. 1.23 40.1% 67/167 0.32 0.17 0.17 NA YES ENO1 6 2023 IPI00465248 enolase 1, (alpha)---Isoform alpha-enolase of Alpha-enolase
132. 1.20 23.4% 39/167 0.24 0.17 0.17 NA YES PAICS 2 10606 IPI00217223 phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase---Multifunctional protein ADE2
133. 3.42 40.7% 68/167 0.32 0.17 0.17 NA YES PCBP2 6 5094 IPI00012066 poly(rC) binding protein 2---poly(rC)-binding protein 2 isoform b
134. 0.19 4.2% 7/167 0.41 0.14 0.17 NA NO PSMD10 1 5716 IPI00003565 proteasome (prosome, macropain) 26S subunit, non-ATPase, 10---26S proteasome non-ATPase regulatory subunit 10
135. 2.66 56.3% 94/167 0.39 0.17 0.17 NA YES RUVBL2 12 10856 IPI00009104 RuvB-like 2 (E. coli)---RuvB-like 2
136. 0.95 37.1% 62/167 0.31 0.17 0.17 NA YES TRIM21 5 6737 IPI00018971 tripartite motif-containing 21---52 kDa Ro protein
137. 2.34 70.1% 117/167 0.40 0.16 0.16 NA YES AIFM1 16 9131 IPI00000690 apoptosis-inducing factor, mitochondrion-associated, 1---Isoform 1 of Apoptosis-inducing factor 1, mitochondrial precursor
138. 0.21 71.9% 120/167 0.28 0.11 0.16 NA YES CCT5 8 22948 IPI00010720 chaperonin containing TCP1, subunit 5 (epsilon)---T-complex protein 1 subunit epsilon
139. 0.33 57.5% 96/167 0.33 0.14 0.16 NA YES CCT6A 9 908 IPI00027626 chaperonin containing TCP1, subunit 6A (zeta 1)---T-complex protein 1 subunit zeta
140. 2.12 35.3% 59/167 0.28 0.16 0.16 NA YES CFL1 4 1072 IPI00012011 cofilin 1 (non-muscle)---Cofilin-1
141. 1.51 42.5% 71/167 0.31 0.16 0.16 NA YES DNAJA2 6 10294 IPI00032406 DnaJ (Hsp40) homolog, subfamily A, member 2---DnaJ homolog subfamily A member 2
142. 2.63 89.8% 150/167 0.45 0.16 0.16 NA YES EEF2 26 1938 IPI00186290 eukaryotic translation elongation factor 2---Elongation factor 2
143. 1.09 71.3% 119/167 0.41 0.16 0.16 NA YES FASN 17 2194 IPI00026781 fatty acid synthase---Fatty acid synthase
144. 0.23 100.0% 167/167 0.49 0.16 0.16 NA NO HSPA5 34 3309 IPI00003362 heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)---HSPA5 protein
145. 0.97 99.4% 166/167 0.49 0.16 0.16 NA YES HSPA9 34 3313 IPI00007765 heat shock 70kDa protein 9 (mortalin)---Stress-70 protein, mitochondrial precursor
146. 1.61 57.5% 96/167 0.36 0.16 0.16 NA YES MTHFD1 11 4522 IPI00218342 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase---C-1-tetrahydrofolate synthase, cytoplasmic
147. 3.37 55.1% 92/167 0.35 0.16 0.16 NA YES NONO 10 4841 IPI00304596 non-POU domain containing, octamer-binding---Non-POU domain-containing octamer-binding protein
148. 2.30 49.7% 83/167 0.33 0.16 0.16 NA YES RUVBL1 8 8607 IPI00021187 RuvB-like 1 (E. coli)---Isoform 1 of RuvB-like 1
149. 0.58 61.1% 102/167 0.37 0.16 0.16 NA YES TCP1 12 6950 IPI00290566 t-complex 1---T-complex protein 1 subunit alpha
150. 1.09 29.9% 50/167 0.26 0.16 0.16 NA YES TUBB6 3 84617 IPI00646779
IPI00641706
tubulin, beta 6---46 kDa protein
151. 2.65 65.3% 109/167 0.39 0.16 0.16 NA YES TUFM 14 7284 IPI00027107 Tu translation elongation factor, mitochondrial---Tu translation elongation factor, mitochondrial
152. 0.43 12.6% 21/167 0.33 0.11 0.16 NA NO CDC37 2 11140 IPI00013122 cell division cycle 37 homolog (S. cerevisiae)---Hsp90 co-chaperone Cdc37
153. 1.91 6.0% 10/167 0.48 0.16 0.16 NA NO KIAA1794 2 55215 IPI00019447 KIAA1794---Isoform 1 of Uncharacterized membrane protein KIAA1794
154. -0.03 4.8% 8/167 0.38 0.13 0.16 NA NO PSMD7 1 5713 IPI00019927 proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 (Mov34 homolog)---26S proteasome non-ATPase regulatory subunit 7
155. 1.98 73.7% 123/167 0.38 0.15 0.15 NA YES ATP5A1 15 498 IPI00440493 ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle---ATP synthase subunit alpha, mitochondrial precursor
156. 0.06 42.5% 71/167 0.22 0.11 0.15 NA YES EIF4A1 3 1973 IPI00025491 eukaryotic translation initiation factor 4A, isoform 1---Eukaryotic initiation factor 4A-I
157. 0.57 100.0% 167/167 0.46 0.15 0.15 NA NO HSPA1L 30 3305 IPI00301277 heat shock 70kDa protein 1-like---Heat shock 70 kDa protein 1L
158. 1.29 25.7% 43/167 0.23 0.15 0.15 NA YES LOC729708 2 729708 IPI00383071 similar to Triosephosphate isomerase (TIM) (Triose-phosphate isomerase)---RcTPI1 (Fragment)
159. 1.42 51.5% 86/167 0.33 0.15 0.15 NA YES PHGDH 8 26227 IPI00011200 phosphoglycerate dehydrogenase---D-3-phosphoglycerate dehydrogenase
160. 2.54 3.6% 6/167 0.44 0.15 0.15 NA NO SUCLG1 1 8802 IPI00759493 succinate-CoA ligase, GDP-forming, alpha subunit---succinate-CoA ligase, GDP-forming, alpha subunit
161. 0.22 32.3% 54/167 0.21 0.12 0.15 NA YES YWHAZ 2 7534 IPI00021263 tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide---14-3-3 protein zeta/delta
162. -0.07 7.2% 12/167 0.31 0.10 0.15 NA NO COPS4 1 51138 IPI00171844 COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis)---COP9 signalosome complex subunit 4
163. -0.03 50.3% 84/167 0.26 0.09 0.15 NA NO DDB1 5 1642 IPI00293464 damage-specific DNA binding protein 1, 127kDa---DNA damage-binding protein 1
164. 3.08 6.6% 11/167 0.46 0.15 0.15 NA NO DOCK7 2 85440 IPI00183572 dedicator of cytokinesis 7---Isoform 2 of Dedicator of cytokinesis protein 7
165. 4.25 3.6% 6/167 0.44 0.15 0.15 NA NO UBE2L3 1 7332 IPI00021347 ubiquitin-conjugating enzyme E2L 3---Ubiquitin-conjugating enzyme E2 L3
166. 0.19 28.7% 48/167 0.22 0.14 0.14 NA YES ALDH18A1 2 5832 IPI00008982 aldehyde dehydrogenase 18 family, member A1---Isoform Long of Delta 1-pyrroline-5-carboxylate synthetase
167. 0.28 63.5% 106/167 0.33 0.14 0.14 NA YES CCT8 10 10694 IPI00302925 chaperonin containing TCP1, subunit 8 (theta)---Chaperonin containing TCP1, subunit 8 (Theta) variant
168. 2.59 12.0% 20/167 0.42 0.14 0.14 NA NO CDC2 3 983 IPI00026689 cell division cycle 2, G1 to S and G2 to M---Hypothetical protein DKFZp686L20222
169. 3.00 15.0% 25/167 0.43 0.14 0.14 NA NO DARS 4 1615 IPI00216951 aspartyl-tRNA synthetase---Aspartyl-tRNA synthetase, cytoplasmic
170. 1.61 64.1% 107/167 0.33 0.14 0.14 NA YES DNAJA1 10 3301 IPI00012535 DnaJ (Hsp40) homolog, subfamily A, member 1---DnaJ homolog subfamily A member 1
171. -0.47 99.4% 166/167 0.43 0.14 0.14 NA YES KRT10 26 3858 IPI00009865 keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris)---Keratin, type I cytoskeletal 10
172. 0.78 38.3% 64/167 0.27 0.14 0.14 NA YES MCM7 4 4176 IPI00299904 MCM7 minichromosome maintenance deficient 7 (S. cerevisiae)---Isoform 1 of DNA replication licensing factor MCM7
173. 2.26 38.3% 64/167 0.27 0.14 0.14 NA YES SSR4 4 6748 IPI00019385 signal sequence receptor, delta (translocon-associated protein delta)---Translocon-associated protein, delta subunit precursor
174. 1.33 99.4% 166/167 0.41 0.14 0.14 NA YES TUBB 24 203068 IPI00011654 tubulin, beta---Tubulin beta chain
175. 3.52 21.0% 35/167 0.41 0.14 0.14 NA NO DLD 5 1738 IPI00015911 dihydrolipoamide dehydrogenase---Dihydrolipoyl dehydrogenase, mitochondrial precursor
176. 3.25 4.2% 7/167 0.41 0.14 0.14 NA NO EIF1AY 1 9086 IPI00647118 eukaryotic translation initiation factor 1A, Y-linked---14 kDa protein
177. 2.72 4.2% 7/167 0.41 0.14 0.14 NA NO IGBP1 1 3476 IPI00019148 immunoglobulin (CD79A) binding protein 1---Immunoglobulin-binding protein 1
178. 3.05 11.4% 19/167 0.43 0.14 0.14 NA NO NDUFS3 3 4722 IPI00025796 NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)---NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial precursor
179. 0.22 28.7% 48/167 0.27 0.09 0.14 NA NO PSMC6 3 5706 IPI00021926 proteasome (prosome, macropain) 26S subunit, ATPase, 6---26S protease regulatory subunit S10B
180. 0.86 9.6% 16/167 0.38 0.13 0.13 NA NO CBR1 2 873 IPI00295386 carbonyl reductase 1---Carbonyl reductase [NADPH] 1
181. 0.43 68.3% 114/167 0.28 0.11 0.13 NA YES CCT4 8 10575 IPI00302927 chaperonin containing TCP1, subunit 4 (delta)---T-complex protein 1 subunit delta
182. -0.32 98.2% 164/167 0.38 0.13 0.13 NA YES HNRPUL1 20 11100 IPI00013070 heterogeneous nuclear ribonucleoprotein U-like 1---Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1
183. 1.13 29.3% 49/167 0.22 0.13 0.13 NA YES HSD17B10 2 3028 IPI00017726 hydroxysteroid (17-beta) dehydrogenase 10---Isoform 1 of 3-hydroxyacyl-CoA dehydrogenase type-2
184. 0.22 77.2% 129/167 0.27 0.10 0.13 NA YES HSP90AA1 8 3320 IPI00382470 heat shock protein 90kDa alpha (cytosolic), class A member 1---Heat shock protein HSP 90-alpha 2
185. 0.38 94.0% 157/167 0.36 0.13 0.13 NA YES HSP90AB1 18 3326 IPI00334775 heat shock protein 90kDa alpha (cytosolic), class B member 1---85 kDa protein
186. 1.57 14.4% 24/167 0.38 0.13 0.13 NA NO MARS 3 4141 IPI00008240 methionyl-tRNA synthetase---Methionyl-tRNA synthetase, cytoplasmic
187. 0.14 31.1% 52/167 0.21 0.13 0.13 NA YES MCM5 2 4174 IPI00018350 MCM5 minichromosome maintenance deficient 5, cell division cycle 46 (S. cerevisiae)---DNA replication licensing factor MCM5
188. 1.07 12.6% 21/167 0.33 0.11 0.13 NA NO NUP155 2 9631 IPI00026625 nucleoporin 155kDa---Isoform 1 of Nuclear pore complex protein Nup155
189. 3.86 18.0% 30/167 0.39 0.13 0.13 NA NO P4HB 4 5034 IPI00010796 procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), beta polypeptide---Protein disulfide-isomerase precursor
190. 3.51 97.6% 163/167 0.39 0.13 0.13 NA YES PRDX1 21 5052 IPI00000874 peroxiredoxin 1---Peroxiredoxin-1
191. 2.72 61.7% 103/167 0.30 0.13 0.13 NA YES PRDX2 8 7001 IPI00027350 peroxiredoxin 2---Peroxiredoxin-2
192. -0.02 8.4% 14/167 0.29 0.10 0.13 NA NO PSMD14 1 10213 IPI00024821 proteasome (prosome, macropain) 26S subunit, non-ATPase, 14---26S proteasome non-ATPase regulatory subunit 14
193. 0.66 30.5% 51/167 0.21 0.13 0.13 NA YES SAMHD1 2 25939 IPI00294739 SAM domain and HD domain 1---SAM domain and HD domain-containing protein 1
194. 0.92 30.5% 51/167 0.21 0.13 0.13 NA YES TUBB4 2 10382 IPI00023598 tubulin, beta 4---Tubulin beta-4 chain
195. 1.76 13.8% 23/167 0.39 0.13 0.13 NA NO XPO1 3 7514 IPI00298961 exportin 1 (CRM1 homolog, yeast)---Exportin-1
196. 1.84 4.8% 8/167 0.38 0.13 0.13 NA NO ACADSB 1 36 IPI00024623 acyl-Coenzyme A dehydrogenase, short/branched chain---Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial precursor
197. 2.87 4.8% 8/167 0.38 0.13 0.13 NA NO COX11 1 1353 IPI00295394 COX11 homolog, cytochrome c oxidase assembly protein (yeast)---Cytochrome c oxidase assembly protein COX11, mitochondrial precursor
198. -0.07 34.7% 58/167 0.20 0.11 0.12 NA YES ACLY 2 47 IPI00021290 ATP citrate lyase---ATP-citrate synthase
199. -0.15 12.0% 20/167 0.34 0.11 0.12 NA NO ATG7 2 10533 IPI00007404 ATG7 autophagy related 7 homolog (S. cerevisiae)---Isoform 1 of Autophagy-related protein 7
200. 1.22 56.3% 94/167 0.27 0.12 0.12 NA YES CTPS 6 1503 IPI00290142 CTP synthase---CTP synthase 1
201. -0.11 13.8% 23/167 0.22 0.07 0.12 NA NO PSMD12 1 5718 IPI00185374 proteasome (prosome, macropain) 26S subunit, non-ATPase, 12---26S proteasome non-ATPase regulatory subunit 12
202. 1.49 26.9% 45/167 0.32 0.11 0.11 NA NO ATP1A2 4 477 IPI00003021 ATPase, Na+/K+ transporting, alpha 2 (+) polypeptide---Sodium/potassium-transporting ATPase alpha-2 chain precursor
203. -0.16 82.6% 138/167 0.22 0.08 0.11 NA YES CLTC 6 1213 IPI00024067 clathrin, heavy chain (Hc)---Isoform 1 of Clathrin heavy chain 1
204. 2.48 12.6% 21/167 0.33 0.11 0.11 NA NO DYNC1LI1 2 51143 IPI00007675 dynein, cytoplasmic 1, light intermediate chain 1---Cytoplasmic dynein 1 light intermediate chain 1
205. 0.48 98.8% 165/167 0.33 0.11 0.11 NA YES EEF1A2 15 1917 IPI00014424 eukaryotic translation elongation factor 1 alpha 2---Elongation factor 1-alpha 2
206. 1.62 35.9% 60/167 0.20 0.11 0.11 NA YES GSTP1 2 2950 IPI00219757 glutathione S-transferase pi---Glutathione S-transferase P
207. -0.70 97.6% 163/167 0.34 0.11 0.11 NA YES NCL 16 4691 IPI00444262
IPI00183526
nucleolin---NCL protein
208. 0.12 72.5% 121/167 0.26 0.10 0.11 NA YES PKM2 7 5315 IPI00220644 pyruvate kinase, muscle---Isoform M1 of Pyruvate kinase isozymes M1/M2
209. 2.43 37.1% 62/167 0.19 0.11 0.11 NA YES PPP2R2B 2 5521 IPI00020850 protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform---Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
210. 0.07 11.4% 19/167 0.25 0.08 0.11 NA NO PSMD4 1 5710 IPI00022694 proteasome (prosome, macropain) 26S subunit, non-ATPase, 4---Isoform Rpn10A of 26S proteasome non-ATPase regulatory subunit 4
211. 1.95 13.8% 23/167 0.32 0.11 0.11 NA NO SLC1A5 2 6510 IPI00019472 solute carrier family 1 (neutral amino acid transporter), member 5---Neutral amino acid transporter B
212. 1.19 56.9% 95/167 0.25 0.11 0.11 NA YES TUBB2A 5 7280 IPI00013475 tubulin, beta 2A---Tubulin beta-2A chain
213. 1.53 41.3% 69/167 0.34 0.11 0.11 NA NO ATP5B 7 506 IPI00303476 ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide---ATP synthase subunit beta, mitochondrial precursor
214. 2.65 12.0% 20/167 0.34 0.11 0.11 NA NO PPP6C 2 5537 IPI00012970 protein phosphatase 6, catalytic subunit---Serine/threonine-protein phosphatase 6
215. 1.52 6.0% 10/167 0.34 0.11 0.11 NA NO SRPRB 1 58477 IPI00295098 signal recognition particle receptor, B subunit---Signal recognition particle receptor subunit beta
216. 0.49 7.2% 12/167 0.31 0.10 0.10 NA NO ASNS 1 440 IPI00554777 asparagine synthetase---Asparagine synthetase
217. 0.71 7.2% 12/167 0.31 0.10 0.10 NA NO HK1 1 3098 IPI00018246 hexokinase 1---Isoform 1 of Hexokinase-1
218. 0.16 100.0% 167/167 0.29 0.10 0.10 NA NO HNRPK 12 3190 IPI00216049 heterogeneous nuclear ribonucleoprotein K---Isoform 1 of Heterogeneous nuclear ribonucleoprotein K
219. 0.40 81.4% 136/167 0.31 0.10 0.10 NA NO HNRPM 11 4670 IPI00171903 heterogeneous nuclear ribonucleoprotein M---Isoform 1 of Heterogeneous nuclear ribonucleoprotein M
220. 0.23 59.9% 100/167 0.24 0.10 0.10 NA YES HSPH1 5 10808 IPI00218993 heat shock 105kDa/110kDa protein 1---Isoform Beta of Heat-shock protein 105 kDa
221. 0.77 15.0% 25/167 0.30 0.10 0.10 NA NO IARS 2 3376 IPI00013234 isoleucyl-tRNA synthetase---IARS protein
222. 0.95 57.5% 96/167 0.22 0.10 0.10 NA YES KPNB1 4 3837 IPI00001639 karyopherin (importin) beta 1---Importin beta-1 subunit
223. -0.71 96.4% 161/167 0.29 0.10 0.10 NA YES KRT2 12 3849 IPI00021304 keratin 2 (epidermal ichthyosis bullosa of Siemens)---Keratin, type II cytoskeletal 2 epidermal
224. 2.80 15.6% 26/167 0.30 0.10 0.10 NA NO PFDN2 2 5202 IPI00006052 prefoldin subunit 2---Prefoldin subunit 2
225. 1.93 7.2% 12/167 0.31 0.10 0.10 NA NO POLR2E 1 5434 IPI00291093 polymerase (RNA) II (DNA directed) polypeptide E, 25kDa---DNA-directed RNA polymerase II 23 kDa polypeptide
226. 1.40 64.1% 107/167 0.23 0.10 0.10 NA YES PPIA 5 5478 IPI00419585 peptidylprolyl isomerase A (cyclophilin A)---Peptidyl-prolyl cis-trans isomerase A
227. 1.61 21.0% 35/167 0.32 0.10 0.10 NA NO RANBP2 3 5903 IPI00221325 RAN binding protein 2---E3 SUMO-protein ligase RanBP2
228. 3.07 14.4% 24/167 0.31 0.10 0.10 NA NO SF1 2 7536 IPI00294627 splicing factor 1---Isoform 2 of Splicing factor 1
229. 0.19 79.6% 133/167 0.26 0.10 0.10 NA YES SLC25A5 8 292 IPI00007188 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5---ADP/ATP translocase 2
230. 1.17 8.4% 14/167 0.29 0.10 0.10 NA NO ST13 1 6767 IPI00032826 suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)---Hsc70-interacting protein
231. -1.16 97.6% 163/167 0.30 0.10 0.10 NA YES TFG 13 10342 IPI00294619 TRK-fused gene---Protein TFG
232. 1.26 15.0% 25/167 0.30 0.10 0.10 NA NO ACAT1 2 38 IPI00030363 acetyl-Coenzyme A acetyltransferase 1 (acetoacetyl Coenzyme A thiolase)---Acetyl-CoA acetyltransferase, mitochondrial precursor
233. 1.32 7.8% 13/167 0.30 0.10 0.10 NA NO ILVBL 1 10994 IPI00554541 ilvB (bacterial acetolactate synthase)-like---ilvB (bacterial acetolactate synthase)-like isoform 1
234. 0.67 26.3% 44/167 0.28 0.09 0.10 NA NO POLR2A 3 5430 IPI00031627 polymerase (RNA) II (DNA directed) polypeptide A, 220kDa---217 kDa protein
235. 2.20 14.4% 24/167 0.31 0.10 0.10 NA NO TROVE2 2 6738 IPI00019450 TROVE domain family, member 2---Isoform Long of 60 kDa SS-A/Ro ribonucleoprotein
236. 0.83 41.9% 70/167 0.18 0.09 0.09 NA YES AHSA1 2 10598 IPI00030706 AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast)---Activator of 90 kDa heat shock protein ATPase homolog 1
237. 0.27 29.3% 49/167 0.15 0.09 0.09 NA YES ATAD3A 1 55210 IPI00295992 ATPase family, AAA domain containing 3A---Isoform 2 of ATPase family AAA domain-containing protein 3A
238. 0.79 18.0% 30/167 0.28 0.09 0.09 NA NO CKB 2 1152 IPI00022977 creatine kinase, brain---Creatine kinase B-type
239. 0.05 79.6% 133/167 0.23 0.09 0.09 NA YES DHX15 6 1665 IPI00396435 DEAH (Asp-Glu-Ala-His) box polypeptide 15---DEAH (Asp-Glu-Ala-His) box polypeptide 15
240. 0.61 9.0% 15/167 0.28 0.09 0.09 NA NO ETFA 1 2108 IPI00010810 electron-transfer-flavoprotein, alpha polypeptide (glutaric aciduria II)---Electron transfer flavoprotein subunit alpha, mitochondrial precursor
241. -0.70 100.0% 167/167 0.26 0.09 0.09 NA NO FUS 10 2521 IPI00221354 fusion (involved in t(12;16) in malignant liposarcoma)---Isoform Short of RNA-binding protein FUS
242. 1.21 19.2% 32/167 0.27 0.09 0.09 NA NO HAX1 2 10456 IPI00010440 HCLS1 associated protein X-1---HS1-associating protein X-1
243. 0.81 39.5% 66/167 0.27 0.09 0.09 NA NO HSPA4L 4 22824 IPI00295485 heat shock 70kDa protein 4-like---Heat shock 70 kDa protein 4L
244. 1.70 18.0% 30/167 0.28 0.09 0.09 NA NO HSPE1 2 3336 IPI00220362 heat shock 10kDa protein 1 (chaperonin 10)---10 kDa heat shock protein, mitochondrial
245. 0.64 28.7% 48/167 0.27 0.09 0.09 NA NO MSH6 3 2956 IPI00106847 mutS homolog 6 (E. coli)---Isoform GTBP-alt of DNA mismatch repair protein MSH6
246. 0.66 59.9% 100/167 0.21 0.09 0.09 NA YES PCNA 4 5111 IPI00021700 proliferating cell nuclear antigen---Proliferating cell nuclear antigen
247. 0.11 87.4% 146/167 0.25 0.09 0.09 NA YES RPL6 8 6128 IPI00329389 ribosomal protein L6---60S ribosomal protein L6
248. 0.87 100.0% 167/167 0.28 0.09 0.09 NA NO TUBA1C 11 84790 IPI00166768 tubulin, alpha 1c---TUBA1C protein
249. 0.22 93.4% 156/167 0.27 0.09 0.09 NA YES TUBB1 10 81027 IPI00006510 tubulin, beta 1---Tubulin beta-1 chain
250. -0.05 22.2% 37/167 0.18 0.06 0.09 NA NO HAT1 1 8520 IPI00024719 histone acetyltransferase 1---Histone acetyltransferase type B catalytic subunit
251. -0.08 16.8% 28/167 0.20 0.07 0.09 NA NO PSMC2 1 5701 IPI00021435 proteasome (prosome, macropain) 26S subunit, ATPase, 2---26S protease regulatory subunit 7
252. 2.21 9.6% 16/167 0.27 0.09 0.09 NA NO TPP1 1 1200 IPI00298237 tripeptidyl peptidase I---Isoform 1 of Tripeptidyl-peptidase 1 precursor
253. 1.31 83.2% 139/167 0.22 0.08 0.08 NA YES ACTB 6 60 IPI00021439 actin, beta---Actin, cytoplasmic 1
254. 1.18 12.0% 20/167 0.24 0.08 0.08 NA NO AK2 1 204 IPI00215901 adenylate kinase 2---Isoform 1 of Adenylate kinase isoenzyme 2, mitochondrial
255. 0.95 11.4% 19/167 0.25 0.08 0.08 NA NO CBR3 1 874 IPI00290462 carbonyl reductase 3---Carbonyl reductase [NADPH] 3
256. 0.25 71.9% 120/167 0.20 0.08 0.08 NA YES CLTCL1 4 8218 IPI00022881 clathrin, heavy chain-like 1---Isoform 1 of Clathrin heavy chain 2
257. -0.80 99.4% 166/167 0.24 0.08 0.08 NA YES DDX3X 8 1654 IPI00215637 DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked---ATP-dependent RNA helicase DDX3X
258. 0.57 80.8% 135/167 0.23 0.08 0.08 NA YES GAPDH 6 2597 IPI00219018 glyceraldehyde-3-phosphate dehydrogenase---Glyceraldehyde-3-phosphate dehydrogenase
259. -0.83 98.8% 165/167 0.24 0.08 0.08 NA YES HNRPA2B1 8 3181 IPI00396378
IPI00386854
heterogeneous nuclear ribonucleoprotein A2/B1---Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1
260. 2.24 98.2% 164/167 0.24 0.08 0.08 NA YES HSPA7 8 3311 IPI00011134 heat shock 70kDa protein 7 (HSP70B)---Heat shock 70 kDa protein 7 (Fragment)
261. 0.96 80.8% 135/167 0.23 0.08 0.08 NA YES KHSRP 6 8570 IPI00298363 KH-type splicing regulatory protein (FUSE binding protein 2)---Far upstream element-binding protein 2
262. -0.04 92.2% 154/167 0.23 0.08 0.08 NA YES NPM1 7 4869 IPI00220740 nucleophosmin (nucleolar phosphoprotein B23, numatrin)---Isoform 2 of Nucleophosmin
263. 0.29 13.2% 22/167 0.23 0.08 0.08 NA NO PYGL 1 5836 IPI00470525 phosphorylase, glycogen; liver (Hers disease, glycogen storage disease type VI)---Glycogen phosphorylase, liver form
264. 0.56 79.6% 133/167 0.21 0.08 0.08 NA YES RPL23 5 9349 IPI00010153 ribosomal protein L23---60S ribosomal protein L23
265. 0.51 97.0% 162/167 0.24 0.08 0.08 NA YES RPLP2 8 6181 IPI00008529 ribosomal protein, large, P2---60S acidic ribosomal protein P2
266. -0.05 89.8% 150/167 0.18 0.06 0.08 NA YES RPS27A 4 6233 IPI00179330 ribosomal protein S27a---ubiquitin and ribosomal protein S27a precursor
267. 0.53 82.0% 137/167 0.23 0.08 0.08 NA YES RPS8 6 6202 IPI00216587 ribosomal protein S8---40S ribosomal protein S8
268. -0.08 56.9% 95/167 0.16 0.07 0.08 NA YES SLC25A6 2 293 IPI00291467 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6---ADP/ATP translocase 3
269. 0.10 37.1% 62/167 0.24 0.08 0.08 NA NO XRCC5 3 7520 IPI00220834 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining; Ku autoantigen, 80kDa)---ATP-dependent DNA helicase 2 subunit 2
270. 1.87 22.2% 37/167 0.25 0.08 0.08 NA NO EIF5A 2 1984 IPI00376005 eukaryotic translation initiation factor 5A---Isoform 2 of Eukaryotic translation initiation factor 5A-1
271. 0.87 25.7% 43/167 0.23 0.08 0.08 NA NO MCCC2 2 64087 IPI00294140 methylcrotonoyl-Coenzyme A carboxylase 2 (beta)---Protein
272. 0.44 13.8% 23/167 0.22 0.07 0.08 NA NO MSH2 1 4436 IPI00017303 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)---DNA mismatch repair protein Msh2
273. 1.05 13.2% 22/167 0.23 0.08 0.08 NA NO PYCR1 1 5831 IPI00376503 pyrroline-5-carboxylate reductase 1---pyrroline-5-carboxylate reductase 1 isoform 2
274. 1.52 24.0% 40/167 0.24 0.08 0.08 NA NO TARDBP 2 23435 IPI00025815 TAR DNA binding protein---TDP43
275. -0.51 76.6% 128/167 0.19 0.07 0.07 NA YES DDX1 4 1653 IPI00293655 DEAD (Asp-Glu-Ala-Asp) box polypeptide 1---ATP-dependent RNA helicase DDX1
276. -0.61 84.4% 141/167 0.18 0.07 0.07 NA YES DDX17 4 10521 IPI00023785 DEAD (Asp-Glu-Ala-Asp) box polypeptide 17---Isoform 1 of Probable ATP-dependent RNA helicase DDX17
277. -1.08 92.8% 155/167 0.19 0.07 0.07 NA YES DHX9 5 1660 IPI00215638 DEAH (Asp-Glu-Ala-His) box polypeptide 9---ATP-dependent RNA helicase A
278. -0.41 77.2% 129/167 0.19 0.07 0.07 NA YES DNAJC10 4 54431 IPI00293260 DnaJ (Hsp40) homolog, subfamily C, member 10---Isoform 1 of DnaJ homolog subfamily C member 10 precursor
279. 0.77 92.8% 155/167 0.21 0.07 0.07 NA YES EEF1A1 6 1915 IPI00025447 eukaryotic translation elongation factor 1 alpha 1---EEF1A1 protein
280. -0.41 100.0% 167/167 0.22 0.07 0.07 NA NO HNRPF 7 3185 IPI00003881 heterogeneous nuclear ribonucleoprotein F---Heterogeneous nuclear ribonucleoprotein F
281. -0.52 99.4% 166/167 0.22 0.07 0.07 NA YES HNRPH1 7 3187 IPI00013881 heterogeneous nuclear ribonucleoprotein H1 (H)---Heterogeneous nuclear ribonucleoprotein H
282. 1.83 17.4% 29/167 0.20 0.07 0.07 NA NO LSM12 1 124801 IPI00410324 LSM12 homolog (S. cerevisiae)---Protein LSM12 homolog
283. 0.27 80.8% 135/167 0.19 0.07 0.07 NA YES RPL12 4 6136 IPI00024933 ribosomal protein L12---60S ribosomal protein L12
284. 0.42 87.4% 146/167 0.20 0.07 0.07 NA YES RPL15 5 6138 IPI00375511 ribosomal protein L15---26 kDa protein
285. -0.01 74.9% 125/167 0.19 0.07 0.07 NA YES RPL23A 4 6147 IPI00021266 ribosomal protein L23a---60S ribosomal protein L23a
286. -0.58 83.8% 140/167 0.18 0.07 0.07 NA YES RPL5 4 6125 IPI00000494 ribosomal protein L5---60S ribosomal protein L5
287. -0.41 95.8% 160/167 0.21 0.07 0.07 NA YES RPLP0 6 6175 IPI00008530 ribosomal protein, large, P0---60S acidic ribosomal protein P0
288. 0.33 77.8% 130/167 0.19 0.07 0.07 NA YES RPS15A 4 6210 IPI00221091 ribosomal protein S15a---40S ribosomal protein S15a
289. -0.67 95.2% 159/167 0.21 0.07 0.07 NA YES RPS3 6 6188 IPI00011253 ribosomal protein S3---40S ribosomal protein S3
290. -0.12 91.0% 152/167 0.21 0.07 0.07 NA YES RPS4X 6 6191 IPI00217030 ribosomal protein S4, X-linked---40S ribosomal protein S4, X isoform
291. -0.75 78.4% 131/167 0.19 0.07 0.07 NA YES SNRP70 4 6625 IPI00219483 small nuclear ribonucleoprotein 70kDa polypeptide (RNP antigen)---Isoform 2 of U1 small nuclear ribonucleoprotein 70 kDa
292. 0.74 82.0% 137/167 0.18 0.07 0.07 NA YES TXN 4 7295 IPI00216298 thioredoxin---Thioredoxin
293. -0.28 68.9% 115/167 0.17 0.06 0.07 NA NO VIM 3 7431 IPI00418471 vimentin---Vimentin
294. 2.11 43.1% 72/167 0.22 0.07 0.07 NA NO ATP6V1G2 3 534 IPI00328343 ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2---HLA-B associated transcript 1
295. 0.46 54.5% 91/167 0.20 0.07 0.07 NA NO EEF1G 3 1937 IPI00000875 eukaryotic translation elongation factor 1 gamma---Elongation factor 1-gamma
296. 1.17 35.9% 60/167 0.20 0.07 0.07 NA NO ENO1B 2 26237 IPI00013769 enolase alpha, lung-specific---Alpha-enolase, lung specific
297. 1.36 34.1% 57/167 0.20 0.07 0.07 NA NO PCMT1 2 5110 IPI00744630 protein-L-isoaspartate (D-aspartate) O-methyltransferase---L-isoaspartyl/D-aspartyl methyltransferase
298. 0.95 31.1% 52/167 0.21 0.07 0.07 NA NO RBM39 2 9584 IPI00163505 RNA binding motif protein 39---Isoform 1 of RNA-binding protein 39
299. 0.35 65.3% 109/167 0.21 0.07 0.07 NA NO RPL27 4 6155 IPI00219155 ribosomal protein L27---60S ribosomal protein L27
300. 0.21 16.8% 28/167 0.20 0.07 0.07 NA NO SLC3A2 1 6520 IPI00027493 solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2---4F2 cell-surface antigen heavy chain
301. -0.24 88.6% 148/167 0.18 0.06 0.06 NA YES C1QBP 4 708 IPI00014230 complement component 1, q subcomponent binding protein---Complement component 1 Q subcomponent-binding protein, mitochondrial precursor
302. 0.67 21.6% 36/167 0.18 0.06 0.06 NA NO CSTB 1 1476 IPI00021828 cystatin B (stefin B)---Cystatin-B
303. -0.88 96.4% 161/167 0.19 0.06 0.06 NA YES DDX5 5 1655 IPI00017617 DEAD (Asp-Glu-Ala-Asp) box polypeptide 5---Probable ATP-dependent RNA helicase DDX5
304. 0.31 86.2% 144/167 0.16 0.06 0.06 NA YES DKFZp686D0972 3 345651 IPI00003269 similar to RIKEN cDNA 4732495G21 gene---hypothetical protein LOC345651
305. 1.19 64.7% 108/167 0.15 0.06 0.06 NA YES EEF1B2 2 1933 IPI00178440 eukaryotic translation elongation factor 1 beta 2---Elongation factor 1-beta
306. -0.55 88.0% 147/167 0.18 0.06 0.06 NA YES EWSR1 4 2130 IPI00009841 Ewing sarcoma breakpoint region 1---CDNA FLJ31747 fis, clone NT2RI2007377, highly similar to RNA-BINDING PROTEIN EWS
307. 0.58 62.3% 104/167 0.15 0.06 0.06 NA YES HIST1H2AE 2 3012 IPI00026272 histone cluster 1, H2ae---Histone H2A type 1-B
308. -0.72 95.8% 160/167 0.17 0.06 0.06 NA YES HNRPH3 4 3189 IPI00013877 heterogeneous nuclear ribonucleoprotein H3 (2H9)---Isoform 1 of Heterogeneous nuclear ribonucleoprotein H3
309. -0.47 71.3% 119/167 0.14 0.06 0.06 NA YES KRT14 2 3861 IPI00384444 keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner)---Keratin, type I cytoskeletal 14
310. 0.25 21.6% 36/167 0.18 0.06 0.06 NA NO MDH2 1 4191 IPI00291006 malate dehydrogenase 2, NAD (mitochondrial)---Malate dehydrogenase, mitochondrial precursor
311. -0.34 65.3% 109/167 0.15 0.06 0.06 NA YES NFKB1 2 4790 IPI00292537 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 (p105)---Isoform 2 of Nuclear factor NF-kappa-B p105 subunit
312. 0.55 19.2% 32/167 0.19 0.06 0.06 NA NO NOP5/NOP58 1 51602 IPI00006379 nucleolar protein NOP5/NOP58---Nucleolar protein NOP5
313. -1.20 91.0% 152/167 0.18 0.06 0.06 NA YES PABPC1 4 26986 IPI00008524 poly(A) binding protein, cytoplasmic 1---Isoform 1 of Polyadenylate-binding protein 1
314. 1.64 58.1% 97/167 0.19 0.06 0.06 NA NO PRDX3 3 10935 IPI00024919 peroxiredoxin 3---Thioredoxin-dependent peroxide reductase, mitochondrial precursor
315. -0.44 83.8% 140/167 0.16 0.06 0.06 NA YES RPL18 3 6141 IPI00215719 ribosomal protein L18---60S ribosomal protein L18
316. -0.39 82.6% 138/167 0.16 0.06 0.06 NA YES RPL21 3 6144 IPI00247583 ribosomal protein L21---60S ribosomal protein L21
317. -0.44 88.6% 148/167 0.18 0.06 0.06 NA YES RPL3 4 6122 IPI00550021 ribosomal protein L3---60S ribosomal protein L3
318. 0.21 74.9% 125/167 0.17 0.06 0.06 NA YES RPL38 3 6169 IPI00215790 ribosomal protein L38---60S ribosomal protein L38
319. 0.90 94.0% 157/167 0.17 0.06 0.06 NA YES RPLP1 4 6176 IPI00008527 ribosomal protein, large, P1---60S acidic ribosomal protein P1
320. -0.60 68.9% 115/167 0.14 0.06 0.06 NA YES RPS13 2 6207 IPI00221089 ribosomal protein S13---40S ribosomal protein S13
321. -0.36 81.4% 136/167 0.19 0.06 0.06 NA NO RPS18 4 6222 IPI00013296 ribosomal protein S18---40S ribosomal protein S18
322. -0.60 88.0% 147/167 0.18 0.06 0.06 NA NO RPS2 4 6187 IPI00013485 ribosomal protein S2---40S ribosomal protein S2
323. 0.22 89.8% 150/167 0.18 0.06 0.06 NA YES RPS24 4 6229 IPI00029750 ribosomal protein S24---Isoform 1 of 40S ribosomal protein S24
324. 0.14 70.7% 118/167 0.14 0.06 0.06 NA YES SDHA 2 6389 IPI00217143 succinate dehydrogenase complex, subunit A, flavoprotein (Fp)---SDHA protein
325. 0.31 63.5% 106/167 0.18 0.06 0.06 NA NO SEC23A 3 10484 IPI00017375 Sec23 homolog A (S. cerevisiae)---Protein transport protein Sec23A
326. -0.76 92.8% 155/167 0.17 0.06 0.06 NA YES SNRPD1 4 6632 IPI00302850 small nuclear ribonucleoprotein D1 polypeptide 16kDa---Small nuclear ribonucleoprotein Sm D1
327. -0.29 72.5% 121/167 0.17 0.06 0.06 NA NO SYNCRIP 3 10492 IPI00018140 synaptotagmin binding, cytoplasmic RNA interacting protein---Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q
328. -0.84 83.8% 140/167 0.16 0.06 0.06 NA YES TAF15 3 8148 IPI00020194 TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa---Isoform Short of TATA-binding protein-associated factor 2N
329. 1.46 85.0% 142/167 0.16 0.06 0.06 NA YES TRAP1 3 10131 IPI00030275 TNF receptor-associated protein 1---Heat shock protein 75 kDa, mitochondrial precursor
330. -0.23 61.7% 103/167 0.15 0.06 0.06 NA YES TRIM28 2 10155 IPI00438229 tripartite motif-containing 28---Isoform 1 of Transcription intermediary factor 1-beta
331. 0.00 57.5% 96/167 0.19 0.06 0.06 NA NO C14orf166 3 51637 IPI00006980 chromosome 14 open reading frame 166---Protein C14orf166
332. 1.38 44.3% 74/167 0.18 0.06 0.06 NA NO EIF5A2 2 56648 IPI00006935 eukaryotic translation initiation factor 5A2---Eukaryotic translation initiation factor 5A-2
333. -0.54 86.8% 145/167 0.18 0.06 0.06 NA NO ILF2 4 3608 IPI00005198 interleukin enhancer binding factor 2, 45kDa---Interleukin enhancer-binding factor 2
334. -0.56 79.0% 132/167 0.19 0.06 0.06 NA NO KRT5 4 3852 IPI00009867 keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types)---Keratin, type II cytoskeletal 5
335. 0.20 62.3% 104/167 0.18 0.06 0.06 NA NO LOC497661 3 497661 IPI00394699 putative NFkB activating protein---Ribosomal protein homolog PD-1
336. -0.13 47.3% 79/167 0.17 0.06 0.06 NA NO PTBP1 2 5725 IPI00179964 polypyrimidine tract binding protein 1---Isoform 1 of Polypyrimidine tract-binding protein 1
337. 0.56 78.4% 131/167 0.19 0.06 0.06 NA NO RPL8 4 6132 IPI00012772 ribosomal protein L8---60S ribosomal protein L8
338. 0.00 47.3% 79/167 0.17 0.06 0.06 NA NO SLC25A3 2 5250 IPI00022202 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3---Isoform A of Phosphate carrier protein, mitochondrial precursor
339. -0.51 72.5% 121/167 0.17 0.06 0.06 NA NO SNRPB 3 6628 IPI00027285 small nuclear ribonucleoprotein polypeptides B and B1---Isoform SM-B' of Small nuclear ribonucleoprotein-associated proteins B and B'
340. -0.08 56.3% 94/167 0.16 0.05 0.05 NA NO ACTA2 2 59 IPI00008603 actin, alpha 2, smooth muscle, aorta---Actin, aortic smooth muscle
341. -0.50 72.5% 121/167 0.14 0.05 0.05 NA YES BAG4 2 9530 IPI00030695 BCL2-associated athanogene 4---BAG family molecular chaperone regulator 4
342. -0.69 82.6% 138/167 0.13 0.05 0.05 NA YES CSDA 2 8531 IPI00031801 cold shock domain protein A---Isoform 1 of DNA-binding protein A
343. -0.14 43.1% 72/167 0.13 0.04 0.05 NA NO DDX6 1 1656 IPI00030320 DEAD (Asp-Glu-Ala-Asp) box polypeptide 6---Probable ATP-dependent RNA helicase DDX6
344. -0.22 86.2% 144/167 0.13 0.05 0.05 NA YES DGAT2L7 2 646409 IPI00397431 diacylglycerol O-acyltransferase 2 like protein 7---similar to monoacylglycerol O-acyltransferase 2
345. 0.14 25.7% 43/167 0.16 0.05 0.05 NA NO EIF4A3 1 9775 IPI00009328 eukaryotic translation initiation factor 4A, isoform 3---Eukaryotic initiation factor 4A-III
346. -0.21 74.3% 124/167 0.14 0.05 0.05 NA NO ELAVL1 2 1994 IPI00301936 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R)---ELAV-like protein 1
347. -0.32 84.4% 141/167 0.13 0.05 0.05 NA YES GFAP 2 2670 IPI00025363 glial fibrillary acidic protein---Isoform 1 of Glial fibrillary acidic protein, astrocyte
348. -0.65 99.4% 166/167 0.14 0.05 0.05 NA NO HNRPA1 3 3178 IPI00215965 heterogeneous nuclear ribonucleoprotein A1---Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1
349. -0.66 76.0% 127/167 0.14 0.05 0.05 NA YES HNRPR 2 10236 IPI00012074 heterogeneous nuclear ribonucleoprotein R---Heterogeneous nuclear ribonucleoprotein R
350. 0.07 73.1% 122/167 0.14 0.05 0.05 NA YES HSP90AA2 2 3324 IPI00031523 heat shock protein 90kDa alpha (cytosolic), class A member 2---Heat shock protein 90 kDa alpha class A member 2 (Fragment)
351. -0.59 76.0% 127/167 0.14 0.05 0.05 NA YES HSPA4 2 3308 IPI00002966 heat shock 70kDa protein 4---Heat shock 70 kDa protein 4
352. -0.04 26.3% 44/167 0.16 0.05 0.05 NA NO LDHA 1 3939 IPI00217966 lactate dehydrogenase A---Isoform 1 of L-lactate dehydrogenase A chain
353. -0.17 72.5% 121/167 0.14 0.05 0.05 NA NO LOC388344 2 388344 IPI00397611 similar to ribosomal protein L13---similar to ribosomal protein L13 isoform 1
354. -0.37 77.2% 129/167 0.13 0.05 0.05 NA YES LOC650788 2 650788 IPI00556589 similar to 40S ribosomal protein S28---similar to 40S ribosomal protein S28
355. 0.65 80.2% 134/167 0.13 0.05 0.05 NA YES MIF 2 4282 IPI00293276 macrophage migration inhibitory factor (glycosylation-inhibiting factor)---Macrophage migration inhibitory factor
356. -0.14 70.1% 117/167 0.14 0.05 0.05 NA NO NAP1L1 2 4673 IPI00023860 nucleosome assembly protein 1-like 1---Nucleosome assembly protein 1-like 1
357. 0.14 31.7% 53/167 0.15 0.05 0.05 NA NO NUDT21 1 11051 IPI00646917 nudix (nucleoside diphosphate linked moiety X)-type motif 21---Cleavage and polyadenylation specificity factor 5
358. 0.30 34.1% 57/167 0.14 0.05 0.05 NA NO PPP1CC 1 5501 IPI00005705 protein phosphatase 1, catalytic subunit, gamma isoform---Isoform Gamma-1 of Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
359. -0.19 76.0% 127/167 0.14 0.05 0.05 NA YES RPL13 2 6137 IPI00465361 ribosomal protein L13---60S ribosomal protein L13
360. -0.02 58.7% 98/167 0.15 0.05 0.05 NA NO RPL19 2 6143 IPI00025329 ribosomal protein L19---60S ribosomal protein L19
361. -0.35 75.4% 126/167 0.14 0.05 0.05 NA YES RPS14 2 6208 IPI00026271 ribosomal protein S14---40S ribosomal protein S14
362. -0.40 55.7% 93/167 0.11 0.05 0.05 NA YES RPS21 1 6227 IPI00017448 ribosomal protein S21---40S ribosomal protein S21
363. -0.42 63.5% 106/167 0.15 0.05 0.05 NA NO RPS25 2 6230 IPI00012750 ribosomal protein S25---40S ribosomal protein S25
364. 0.36 74.3% 124/167 0.14 0.05 0.05 NA YES SNRPC 2 6631 IPI00013396 small nuclear ribonucleoprotein polypeptide C---U1 small nuclear ribonucleoprotein C
365. 1.55 26.9% 45/167 0.16 0.05 0.05 NA NO TUBB2B 1 347733 IPI00031370 tubulin, beta 2B---Tubulin beta-2B chain
366. 1.15 55.1% 92/167 0.16 0.05 0.05 NA NO CCBL2 2 56267 IPI00061178 cysteine conjugate-beta lyase 2---RNA binding motif protein, X-linked-like 1
367. -0.73 82.0% 137/167 0.16 0.05 0.05 NA NO DDX21 3 9188 IPI00015953 DEAD (Asp-Glu-Ala-Asp) box polypeptide 21---Isoform 1 of Nucleolar RNA helicase 2
368. -0.11 33.5% 56/167 0.14 0.05 0.05 NA NO GNB2L1 1 10399 IPI00641950 guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1---Lung cancer oncogene 7
369. 0.06 32.9% 55/167 0.14 0.05 0.05 NA NO HSPA2 1 3306 IPI00007702 heat shock 70kDa protein 2---Heat shock-related 70 kDa protein 2
370. 0.04 58.7% 98/167 0.15 0.05 0.05 NA NO KRT24 2 192666 IPI00004550 keratin 24---Keratin-24
371. -0.23 77.8% 130/167 0.16 0.05 0.05 NA NO RPS20 3 6224 IPI00012493 ribosomal protein S20---40S ribosomal protein S20
372. 0.10 30.5% 51/167 0.15 0.05 0.05 NA NO SFPQ 1 6421 IPI00010740 splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)---Isoform Long of Splicing factor, proline- and glutamine-rich
373. -0.71 74.3% 124/167 0.10 0.04 0.04 NA YES HIST2H2BE 1 8349 IPI00003935 histone cluster 2, H2be---Histone H2B type 2-E
374. -0.60 70.7% 118/167 0.10 0.04 0.04 NA YES HNRPA0 1 10949 IPI00011913 heterogeneous nuclear ribonucleoprotein A0---Heterogeneous nuclear ribonucleoprotein A0
375. -0.81 91.0% 152/167 0.12 0.04 0.04 NA YES HNRPAB 2 3182 IPI00334587
IPI00106509
heterogeneous nuclear ribonucleoprotein A/B---Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B
376. -0.46 82.0% 137/167 0.13 0.04 0.04 NA NO HNRPC 2 3183 IPI00216592 heterogeneous nuclear ribonucleoprotein C (C1/C2)---Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2
377. -0.88 94.0% 157/167 0.12 0.04 0.04 NA YES HNRPD 2 3184 IPI00028888 heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)---Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0
378. -0.84 73.7% 123/167 0.10 0.04 0.04 NA YES HNRPH2 1 3188 IPI00026230 heterogeneous nuclear ribonucleoprotein H2 (H')---Heterogeneous nuclear ribonucleoprotein H'
379. -1.16 91.0% 152/167 0.12 0.04 0.04 NA NO HNRPU 2 3192 IPI00386491 heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)---Heterogeneous nuclear ribonucleoprotein U
380. -0.45 76.0% 127/167 0.10 0.03 0.04 NA NO KRT13 1 3860 IPI00009866 keratin 13---Isoform 1 of Keratin, type I cytoskeletal 13
381. 1.41 88.6% 148/167 0.12 0.04 0.04 NA YES LOC729611 2 729611 IPI00052885 similar to 60S ribosomal protein L29 (Cell surface heparin-binding protein HIP)---similar to 60S ribosomal protein L29
382. -0.83 62.3% 104/167 0.11 0.04 0.04 NA YES PLOD1 1 5351 IPI00027192 procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1---Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursor
383. -0.28 95.2% 159/167 0.12 0.04 0.04 NA YES RPL11 2 6135 IPI00376798 ribosomal protein L11---Isoform 1 of 60S ribosomal protein L11
384. -0.06 81.4% 136/167 0.13 0.04 0.04 NA NO RPL31 2 6160 IPI00026302 ribosomal protein L31---60S ribosomal protein L31
385. -0.54 68.9% 115/167 0.10 0.04 0.04 NA YES RPS10 1 6204 IPI00008438 ribosomal protein S10---40S ribosomal protein S10
386. -0.47 56.9% 95/167 0.11 0.04 0.04 NA NO RPS17 1 6218 IPI00221093 ribosomal protein S17---40S ribosomal protein S17
387. -0.80 84.4% 141/167 0.13 0.04 0.04 NA NO HIST1H1C 2 3006 IPI00217465 histone cluster 1, H1c---Histone H1.2
388. -0.84 92.2% 154/167 0.12 0.04 0.04 NA NO KRT75 2 9119 IPI00005859 keratin 75---Keratin-75
389. -0.26 55.1% 92/167 0.11 0.04 0.04 NA NO LOC285176 1 285176 IPI00175098 similar to ribosomal protein L10---similar to ribosomal protein L10
390. -0.28 82.6% 138/167 0.13 0.04 0.04 NA NO SNRPD3 2 6634 IPI00017964 small nuclear ribonucleoprotein D3 polypeptide 18kDa---Small nuclear ribonucleoprotein Sm D3
391. -0.39 61.7% 103/167 0.11 0.04 0.04 NA NO YBX1 1 4904 IPI00031812 Y box binding protein 1---Nuclease sensitive element-binding protein 1
392. -1.03 91.6% 153/167 0.09 0.03 0.03 NA YES RPL14 1 9045 IPI00002821 ribosomal protein L14---60S ribosomal protein L14
393. -0.54 74.9% 125/167 0.10 0.03 0.03 NA NO RPS23 1 6228 IPI00218606 ribosomal protein S23---40S ribosomal protein S23
394. -1.08 80.2% 134/167 0.09 0.03 0.03 NA YES SSB 1 6741 IPI00009032 Sjogren syndrome antigen B (autoantigen La)---Lupus La protein
395. -1.09 77.8% 130/167 0.09 0.03 0.03 NA NO C22orf28 1 51493 IPI00550689 chromosome 22 open reading frame 28---UPF0027 protein C22orf28
396. -1.13 79.0% 132/167 0.09 0.03 0.03 NA NO IGF2BP1 1 10642 IPI00008557 insulin-like growth factor 2 mRNA binding protein 1---Insulin-like growth factor 2 mRNA-binding protein 1
397. -1.14 85.6% 143/167 0.09 0.03 0.03 NA NO RPL24 1 6152 IPI00306332 ribosomal protein L24---60S ribosomal protein L24